Lmo1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Lmo1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lmo1. Synthetic peptide located within the following region: NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGHLNGTFESQVQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	LIM domain only 1
Database Link	NP_620812 Entrez Gene 245979 Rat
Background	Lmo1 is a dopamine-inducible transcription factor in astrocytes.
Synonyms	MGC116692; RBTN1; RHOM1; TTG1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 86%; Rabbit: 86%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.