Nfe2 Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Nfe2 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2. Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | nuclear factor, erythroid derived 2 |
Database Link | |
Background | Nfe2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation.It binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. It requires MAFK or other small MAF proteins for binding to the NF-E2 motif. It may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron. |
Synonyms | NF-E2; p45 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Horse: 79% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Punicalagin improves hepatic lipid metabolism via modulation of oxidative stress and mitochondrial biogenesis in hyperlipidemic mice
,Cao, K;Wang, K;Yang, M;Liu, X;Lv, W;Liu, J;,
Food Funct.
,PubMed ID 32975274
[NFE2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |