NFIL3 Rabbit Polyclonal Antibody

CAT#: TA329213

Rabbit Polyclonal anti-NFIL3 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of nuclear factor, interleukin 3 regulated (NFIL3)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 51 kDa
Gene Name nuclear factor, interleukin 3 regulated
Background NFIL3 is a basic leucine zipper (bZIP) transcription factor that represses or activates transcription in non-osteoblastic cells. NFIL3 play a role in attenuation of PTH target gene transcription in osteoblasts. NFIL3 repression domain interacts specifically with the TBP binding repressor protein Dr1.Glucocorticoid-mediated upregulation of the bZIP transcriptional repressor gene, NFIL3, is dependent on [Ca2+]i levels, and correlates with Glucocorticoid-evoked apoptosis of Glucocorticoid-sensitive CEM-C7-14 cells. NFIL3 is involved in a distinct growth factor-regulated signaling pathway that is responsible for the survival of early B-cell progenitors, and whose alteration by E2A-HLF leads to childhood B lineage leukemia.
Synonyms E4BP4; IL3BP1; NF-IL3A; NFIL3A
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...