CP2c (TFCP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFCP2 antibody: synthetic peptide directed towards the N terminal of human TFCP2. Synthetic peptide located within the following region: YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	transcription factor CP2
Database Link	NP_005644 Entrez Gene 7024 Human UniProt ID Q12800
Background	TFCP2 binds a variety of cellular and viral promoters including fibrinogen, alpha-globin, SV40 and HIV-1 promoters. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with UBP1. It also functions as part of the SSP (stage selector protein) complex. TFCP2 facilitates the interaction of the gamma-globin genes with enhancer elements contained in the locus control region in fetal erythroid cells. It interacts by binding to the stage selector element (SSE) in the proximal gamma-globin promoter.
Synonyms	LBP1C; LSF; LSF1D; SEF; TFCP2C
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.