Pdcd2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Pdcd2 antibody is: synthetic peptide directed towards the middle region of Rat Pdcd2. Synthetic peptide located within the following region: AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	programmed cell death 2
Database Link	NP_113826 Entrez Gene 58934 Rat UniProt ID P47816
Background	Pdcd2 may bind DNA and play a role in programmed cell death.
Synonyms	MGC12347; RP8; ZMYND7
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Goat: 90%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Zebrafish: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.