RGS9 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RGS9 antibody: synthetic peptide directed towards the middle region of human RGS9. Synthetic peptide located within the following region: LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 77 kDa |
| Gene Name | regulator of G-protein signaling 9 |
| Database Link | |
| Background | RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation. |
| Synonyms | PERRS; RGS9L |
| Note | Immunogen sequence homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Rat: 85%; Horse: 85% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
