C1orf25 (TRMT1L) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1ORF25 antibody: synthetic peptide directed towards the N terminal of human C1ORF25. Synthetic peptide located within the following region: QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	tRNA methyltransferase 1 like
Database Link	NP_112196 Entrez Gene 81627 Human UniProt ID Q7Z2T5
Background	Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known.
Synonyms	bG120K12.3; C1orf25; MST070; MSTP070; TRM1L
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.