L3MBTL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2. Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	L3MBTL2 polycomb repressive complex 1 subunit
Database Link	NP_113676 Entrez Gene 83746 Human UniProt ID Q969R5
Background	L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Synonyms	H-l(3)mbt-l; L3MBT
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 86%; Mouse: 80%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.