KCNA3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivity	Human, Mouse, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus.
Formulation	Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Reconstitution Method	Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification	The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST-fusion protein. The antibody was then affinity purified on immo
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Gene Name	potassium voltage-gated channel subfamily A member 3
Database Link	NP_002223 Entrez Gene 16491 MouseEntrez Gene 29731 RatEntrez Gene 3738 Human UniProt ID P22001
Background	KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. It is in these cells (particularly T lymphocytes) that KV1.3 function has centered a lot of attention. It was found that KV1.3 is the main channel.Responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.Based on the central role of Kv1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.
Synonyms	HGK5; HLK3; HPCN3; HUKIII; KV1.3; MK3; PCN3
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.