TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DG1/447 + DOG-1.1]

Specifications

Product Data
Clone Name	DG1/447 + DOG-1.1
Applications	IHC
Recommend Dilution	Immunohistochemistry on Formalin-fixed Sections: 1.0 - 2.0 μg/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes. Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Reactivity	Human
Host	Mouse
Clonality	Monoclonal
Immunogen	Recombinant Human DOG-1 protein (DG1/447) and a synthetic peptide from Human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Specificity	Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%. Cellular Localization: Cell Surface and Cytoplasmic.
Formulation	10mM PBS State: Purified State: Liquid purified IgG fraction from Bioreactor Concentrate Stabilizer: 0.05% BSA Preservative: 0.05% Sodium Azide
Concentration	lot specific
Purification	Protein A/G Chromatography
Conjugation	Unconjugated
Storage Condition	Store undiluted at 2-8°C.
Predicted Protein Size	~114 kDa
Gene Name	anoctamin 1
Database Link	Entrez Gene 55107 Human UniProt ID Q5XXA6
Background	DOG1 gene, a gastrointestinal stromal tumor (GIST) specific gene, encoding for the hypothetical protein FLJ10261, which was named Discovered on GIST 1 (DOG1). DOG1 protein is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFR alpha mutation status.
Synonyms	Anoctamin-1, Transmembrane protein 16A, DOG-1, ORAOV2, TAOS2, TMEM16A
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.