TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]

CAT#: AM33350PU-S

TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Purified

Size: 20 ug 100 ug



Need it in bulk or conjugated?
Get a free quote

CNY 5830.00


货期*
5周

规格
    • 100 ug

Product images

Specifications

Product Data
Clone Name DOG1.1
Applications IHC
Recommend Dilution Immunohistochemistry on Formalin-fixed Sections: 1.0 - 2.0 μg/ml for 30 minutes at RT.
Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes.
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Reactivity Human
Host Mouse
Clonality Monoclonal
Immunogen A synthetic peptide from Human DOG-1 protein (MSDFV DWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSP APSHAYHGGVL), conjugated to a carrier protein.
Specificity Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%.
Cellular Localization: Cell Surface and Cytoplasmic.
Isotype IgG1
Formulation 10mM PBS
State: Purified
State: Liquid purified IgG fraction from Bioreactor Concentrate
Stabilizer: 0.05% BSA
Preservative: 0.05% Sodium Azide
Concentration lot specific
Purification Protein A/G Chromatography
Conjugation Unconjugated
Storage Condition Store undiluted at 2-8°C.
Predicted Protein Size ~114 kDa
Gene Name anoctamin 1
Background DOG1 gene, a gastrointestinal stromal tumor (GIST) specific gene, encoding for the hypothetical protein FLJ10261, which was named Discovered on GIST 1 (DOG1). DOG1 protein is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFR alpha mutation status.
Synonyms Anoctamin-1, Transmembrane protein 16A, DOG-1, ORAOV2, TAOS2, TMEM16A
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...