KCNB2 Mouse Monoclonal Antibody [Clone ID: N372B/1]

CAT#: 75-369

KCNB2 mouse monoclonal antibody, clone N372B/1



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name N372B/1
Applications IF, IHC, WB
Recommend Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Reactivity Human, Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)
Mouse: 94% identity (180/191 amino acids identical).
Human: 84% identity (161/191 amino acids identical).
<50% identity with Kv2.1 and other Kv2 channels.
100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP).
Specificity Does not cross-react with Kv2.2 short isoform.
Does not cross-react with Kv2.1.
Isotype IgG1
Formulation State: Purified
Conjugation Unconjugated
Synonyms Voltage-gated potassium channel subunit Kv2.2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...