Reep1 Mouse Monoclonal Antibody [Clone ID: N345/51]

CAT#: 75-313

Reep1 mouse monoclonal antibody, clone N345/51



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name N345/51
Applications IF, IHC, WB
Recommend Dilution Immunoblot (IB).
Immunocytochemistry (ICC).
Immunohistochemistry (IHC).
Reactivity Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4).
Rat: 97% identity (89/91 amino acids identical)
Human: 95% identity (87/91 amino acids identical)
Isotype IgG2b
Formulation State: Purified
Conjugation Unconjugated
Gene Name receptor accessory protein 1
Synonyms C2orf23
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...