BAF53b (ACTL6B) Mouse Monoclonal Antibody [Clone ID: N332B/15]

CAT#: 75-311

BAF53b (ACTL6B) mouse monoclonal antibody, clone N332B/15



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name N332B/15
Applications IF, IHC, WB
Recommend Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Reactivity Human, Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (also known as 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalpha, ACTL6B and ACTL6, accession number O94805).
Mouse: 98% identity (75/76 amino acids identical).
Rat: 98% identity (75/76 amino acids identical).
>50% identity with BAF53a.
Specificity Does not cross-react with BAF53a
Isotype IgG1
Formulation State: Purified
Conjugation Unconjugated
Gene Name actin like 6B
Synonyms ACTL6, BAF53B, Actin-like protein 6B, ArpNalpha
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...