Kcnmb2 Mouse Monoclonal Antibody [Clone ID: N53/32]
CAT#: 75-087
Kcnmb2 mouse monoclonal antibody, clone N53/32
Need it in bulk or conjugated?
Get a free quote
CNY 6578.00
货期*
3周
规格
Specifications
Product Data | |
Clone Name | N53/32 |
Applications | IF, IP, WB |
Recommend Dilution | Immunoblot (IB) Immunocytochemistry (ICC) Immunoprecipitation (IP) |
Reactivity | Human, Mouse, Rat |
Host | Mouse |
Clonality | Monoclonal |
Immunogen | Fusion protein amino acids 1-41 (MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK, cytoplasmic N-terminus) and 218-235 (KLTQYLSLLCERIQRINR, cytoplasmic C-terminus) of mouse BKBeta2 (also known as BK channel subunit beta-2, Calcium-activated potassium channel subunit beta-2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, K(VCA)beta-2, Maxi K channel subunit beta-2, Slobeta-2 and Kcnmb2, accession number Q9CZM9). Human: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively) Rat: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively) <50% identity with other BKBeta subunits |
Specificity | No cross-reactivity against BKBeta1, BKBeta3 or BKBeta4 |
Isotype | IgG1 |
Formulation | State: Purified |
Conjugation | Unconjugated |
Gene Name | potassium large conductance calcium-activated channel, subfamily M, beta member 2 |
Database Link | |
Synonyms | BKbeta2, Hbeta2, Hbeta3, K(VCA)beta-2, Slo-beta-2 |
Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
Customer
Reviews
Loading...