KIR2.3 (KCNJ4) Mouse Monoclonal Antibody [Clone ID: N25/35]

CAT#: 75-069

KIR2.3 (KCNJ4) mouse monoclonal antibody, clone N25/35



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name N25/35
Applications IF, IHC, WB
Recommend Dilution Immunoblot (IB).
Immunocytochemistry (ICC).
Immunohistochemistry (IHC)
Reactivity Human, Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 390-445 (cytoplasmic C-terminus, EAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI) of human Kir2.3 (also known as Inward rectifier potassium channel subfamily J member 4, KCNJ4, Brain inwardly rectifying K(+) channel 2, Hippocampal inward rectifier, HIRK2, HRK1, HIR, IRK3 and BIR11, accession number P48050).
Mouse: 94% identity (54/57 amino acids identical)
Rat: 94% identity (54/57 amino acids identical)
<50% identity with Kir2.1 and Kir2.2
Specificity Does not cross-react with Kir2.1 or Kir2.2
Isotype IgG1
Formulation State: Purified
Conjugation Unconjugated
Gene Name potassium voltage-gated channel subfamily J member 4
Synonyms KCNJ4, Inward rectifier K(+) channel Kir2.3, Hippocampal inward rectifier, HIRK2, HRK1, HIR, Inward rectifier potassium channel 4
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...