CASK Mouse Monoclonal Antibody [Clone ID: K56A/50]

CAT#: 75-000

CASK mouse monoclonal antibody, clone K56A/50



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Cited in 1 publication.

Product images

Specifications

Product Data
Clone Name K56A/50
Applications IHC, IP, WB
Recommend Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunoprecipitation (IP)
Reactivity Human, Mouse, Rat, Xenopus, Zebrafish
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 318-415 (first L27 domain, NSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEE) of human Peripheral plasma membrane protein CASK (also known as Calcium/calmodulin-dependent serine protein kinase, Protein lin-2 homolog and LIN2, accession number O14936)
Rat: 100% identity (98/98 amino acids identical)
Mouse: 100% identity (98/98 amino acids identical)
Isotype IgG1
Formulation State: Purified
Conjugation Unconjugated
Gene Name calcium/calmodulin dependent serine protein kinase
Synonyms Lin-2 homolog, LIN2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...