HMGN3 (NM_004242) Human Tagged ORF Clone
CAT#: RC213403
HMGN3 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1
ORF Plasmid: tGFP
"NM_004242" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | PNAS-24; PNAS-25; TRIP7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213403 representing NM_004242
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGAAGAGAAAGTCTCCAGAGAATACAGAGGGCAAAGATGGATCCAAAGTAACTAAACAGGAGCCCA CAAGACGGTCTGCCAGATTGTCAGCGAAACCTGCTCCACCAAAACCTGAACCCAAACCAAGAAAAACATC TGCTAAGAAAGAACCTGGAGCAAAGATTAGCAGAGGTGCTAAAGGGAAGAAGGAGGAAAAGCAGGAAGCT GGAAAGGAAGGTACTGCACCATCTGAAAATGGTGAAACTAAAGCTGAAGAGGCACAGAAAACTGAATCTG TAGATAACGAGGGAGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213403 representing NM_004242
Red=Cloning site Green=Tags(s) MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA GKEGTAPSENGETKAEEAQKTESVDNEGE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_004242 |
ORF Size | 297 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004242.4 |
RefSeq Size | 935 bp |
RefSeq ORF | 300 bp |
Locus ID | 9324 |
UniProt ID | Q15651 |
Domains | HMG14_17 |
Protein Families | Druggable Genome |
MW | 10.5 kDa |
Gene Summary | The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213403L1 | Lenti ORF clone of Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC213403L2 | Lenti ORF clone of Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC213403L3 | Lenti ORF clone of Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC213403L4 | Lenti ORF clone of Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG213403 | HMGN3 (tGFP-tagged) - Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1 |
CNY 2,800.00 |
|
SC125366 | HMGN3 (untagged)-Human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1 |
CNY 1,200.00 |