GADD45B (NM_015675) Human Tagged ORF Clone
CAT#: RC213354
GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)
ORF Plasmid: tGFP
"NM_015675" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GADD45BETA; MYD118 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213354 representing NM_015675
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGG AGGAGCTTTTGGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGAT GAATGTGGACCCAGACAGCGTGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCC CTGCAAATCCACTTCACGCTCATCCAGTCCTTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGG GCAATGCGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGAGACCCAGGGCACCACCGAGGCCCGAGACCT CCACTGTCTTCCCTTCCTACAGAACCCTCACACGGACGCCTGGAAGAGCCACGGCTTGGTGGAGGTGGCC AGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213354 representing NM_015675
Red=Cloning site Green=Tags(s) MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA LQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVA SYCEESRGNNQWVPYISLQER myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_015675 |
ORF Size | 483 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_015675.1, NP_056490.1 |
RefSeq Size | 1121 bp |
RefSeq ORF | 483 bp |
Locus ID | 4616 |
UniProt ID | O75293 |
Domains | Ribosomal_L7Ae |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
MW | 17.6 kDa |
Gene Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
A signaling cascade including ARID1A, GADD45B and DUSP1 induces apoptosis and affects the cell cycle of germ cell cancers after romidepsin treatment
,null,
Oncotarget
,PubMed ID 27572311
[GADD45B]
|
Induction of DNA Damage-Inducible Gene GADD45ß Contributes to Sorafenib-Induced Apoptosis in Hepatocellular Carcinoma Cells
,Da-Liang Ou, Ying-Chun Shen, Sung-Liang Yu, Kuen-Feng Chen, Pei-Yen Yeh, Hsiang-Hsuan Fan, Wen-Chi Feng, Ching-Tzu Wang, Liang-In Lin, Chiun Hsu, and Ann-Lii Cheng,
Cancer Res., Nov 2010; 70: 9309 - 9318
[GADD45B]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213354L1 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC213354L2 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged |
CNY 5,890.00 |
|
RC213354L3 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC213354L4 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged |
CNY 3,600.00 |
|
RG213354 | GADD45B (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B) |
CNY 2,800.00 |
|
SC114608 | GADD45B (untagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B) |
CNY 1,200.00 |
其它GADD45B产品