COX8A (NM_004074) Human Tagged ORF Clone
CAT#: RC209065
- TrueORF®
COX8A (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A)
ORF Plasmid: tGFP
"NM_004074" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | COX; COX8; COX8-2; COX8L; MC4DN15; VIII; VIII-L |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209065 representing NM_004074
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCAGTGCCGCGCG CCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTGGCCGTTGGGCTTACCTCCTG CTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCACACCTGGAGACCTACAGGAGGCCAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209065 representing NM_004074
Red=Cloning site Green=Tags(s) MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004074 |
ORF Size | 207 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004074.3 |
RefSeq Size | 521 bp |
RefSeq ORF | 210 bp |
Locus ID | 1351 |
UniProt ID | P10176 |
Domains | COX8 |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 7.4 kDa |
Gene Summary | The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209065L1 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC209065L2 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A), mGFP tagged |
CNY 5,890.00 |
|
RC209065L3 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC209065L4 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A), mGFP tagged |
CNY 5,890.00 |
|
RG209065 | COX8A (tGFP-tagged) - Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A) |
CNY 4,370.00 |
|
SC126992 | COX8A (untagged)-Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A) |
CNY 1,800.00 |