Psoriasin (S100A7) (NM_002963) Human Tagged ORF Clone
CAT#: RC204490
S100A7 (Myc-DDK-tagged)-Human S100 calcium binding protein A7 (S100A7)
ORF Plasmid: tGFP
"NM_002963" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | PSOR1; S100A7c |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204490 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCAACACTCAAGCTGAGAGGTCCATAATAGGCATGATCGACATGTTTCACAAATACACCAGACGTG ATGACAAGATTGACAAGCCAAGCCTGCTGACGATGATGAAGGAGAACTTCCCCAACTTCCTTAGTGCCTG TGACAAAAAGGGCACAAATTACCTCGCCGATGTCTTTGAGAAAAAGGACAAGAATGAGGATAAGAAGATT GATTTTTCTGAGTTTCTGTCCTTGCTGGGAGACATAGCCACAGACTACCACAAGCAGAGCCATGGAGCAG CGCCCTGTTCCGGGGGCAGCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204490 protein sequence
Red=Cloning site Green=Tags(s) MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002963 |
ORF Size | 303 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002963.4 |
RefSeq Size | 450 bp |
RefSeq ORF | 306 bp |
Locus ID | 6278 |
UniProt ID | P31151 |
Protein Families | Secreted Protein |
MW | 11.5 kDa |
Gene Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. [provided by RefSeq, Nov 2014] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Tumor-suppressive Effects of Psoriasin (S100A7) Are Mediated through the ß-Catenin/T Cell Factor 4 Protein Pathway in Estrogen Receptor-positive Breast Cancer Cells
,Yadwinder S. Deol, Mohd W. Nasser, Lianbo Yu, Xianghong Zou, and Ramesh K. Ganju,
J. Biol. Chem., Dec 2011; 286: 44845 - 44854.
[Psoriasin]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204490L1 | Lenti ORF clone of Human S100 calcium binding protein A7 (S100A7), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC204490L2 | Lenti ORF clone of Human S100 calcium binding protein A7 (S100A7), mGFP tagged |
CNY 5,890.00 |
|
RC204490L3 | Lenti ORF clone of Human S100 calcium binding protein A7 (S100A7), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC204490L4 | Lenti ORF clone of Human S100 calcium binding protein A7 (S100A7), mGFP tagged |
CNY 4,200.00 |
|
RG204490 | S100A7 (tGFP-tagged) - Human S100 calcium binding protein A7 (S100A7) |
CNY 3,400.00 |
|
SC122639 | S100A7 (untagged)-Human S100 calcium binding protein A7 (S100A7) |
CNY 1,800.00 |
其它Psoriasin产品