POLR2L (NM_021128) Human Tagged ORF Clone
CAT#: RC200649
POLR2L (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)
ORF Plasmid: tGFP
"NM_021128" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | hRPB7.6; RBP10; RPABC5; RPB7.6; RPB10; RPB10beta |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200649 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCATCCCTGTACGCTGCTTCACTTGTGGCAAGATCGTCGGCAACAAGTGGGAGGCTTACCTGGGGC TGCTGCAGGCCGAGTACACCGAGGGGGACGCGCTGGATGCCCTGGGCCTGAAGCGCTACTGCTGCCGCCG GATGCTGCTGGCCCACGTGGACCTGATCGAGAAGCTGCTCAATTATGCACCCCTGGAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200649 protein sequence
Red=Cloning site Green=Tags(s) MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_021128 |
ORF Size | 201 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_021128.3, NP_066951.1 |
RefSeq Size | 925 bp |
RefSeq ORF | 204 bp |
Locus ID | 5441 |
UniProt ID | P62875 |
Domains | RNA_pol_N |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
MW | 7.6 kDa |
Gene Summary | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200649L3 | Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC200649L4 | Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L), mGFP tagged |
CNY 5,890.00 |
|
RG200649 | POLR2L (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L) |
CNY 2,800.00 |
|
SC112974 | POLR2L (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L) |
CNY 1,200.00 |