United States
Germany
Japan
United Kingdom
China
Gsk3b (NM_019827) Mouse Tagged ORF Clone
CAT＃: MR206669
- TrueORF®
Gsk3b (Myc-DDK-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b)
ORF Plasmid: tGFP
"NM_019827" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 5,488.00
| Cited in 1 publication. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | 7330414F15Rik; 8430431H08Rik; C86142; GSK-3; GSK-3beta; GSK3 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MR206669 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGGGCGACCGAGAACCACCTCCTTTGCGGAGAGCTGCAAGCCAGTGCAGCAGCCTTCAGCTTTTG GTAGCATGAAAGTTAGCAGAGATAAAGATGGCAGCAAGGTAACCACAGTAGTGGCAACTCCTGGCCAGGG TCCTGACAGGCCACAGGAAGTCAGTTATACAGACACGAAAGTGATTGGAAATGGATCATTTGGTGTGGTA TATCAAGCCAAACTTTGTGATTCTGGAGAACTGGTTGCCATCAAGAAAGTTCTACAGGACAAGCGATTTA AGAACCGAGAGCTCCAGATCATGAGAAAGCTAGACCACTGTAACATAGTCCGACTGCGGTATTTCTTCTA CTCGAGTGGTGAGAAGAAAGATGAGGTCTACCTTAACCTGGTGCTGGACTATGTTCCGGAGACAGTGTAC AGAGTCGCCAGACACTATAGTCGAGCCAAGCAGACACTCCCTGTGATCTATGTCAAGTTGTATATGTATC AGCTGTTCAGAAGTCTAGCCTATATCCATTCCTTTGGAATCTGCCATCGAGACATTAAACCACAGAACCT CTTGTTGGATCCTGATACAGCTGTATTAAAACTCTGTGACTTTGGAAGTGCAAAGCAGCTGGTCCGAGGA GAGCCCAATGTTTCATATATCTGTTCTCGGTACTACAGGGCACCAGAGTTGATCTTTGGAGCCACTGATT ACACGTCCAGTATAGATGTATGGTCTGCAGGCTGTGTGTTGGCTGAATTGTTGCTAGGACAACCAATATT TCCTGGGGACAGTGGTGTGGATCAGTTGGTGGAAATAATAAAGGTCCTAGGAACACCAACAAGGGAGCAA ATTAGAGAAATGAACCCAAATTATACAGAATTCAAATTCCCTCAAATCAAGGCACATCCTTGGACAAAGG TCTTCCGGCCCCGAACTCCACCAGAGGCAATTGCACTGTGCAGCCGTCTGCTGGAGTACACACCTACCGC CCGGCTAACACCACTGGAAGCTTGTGCACATTCATTTTTCGATGAATTGCGGGACCCAAATGTCAAACTA CCAAATGGGCGAGACACACCTGCACTCTTCAACTTTACCACTCAAGAACTGTCAAGTAACCCCCCTCTGG CCACCATCCTTATCCCTCCACATGCTCGGATTCAGGCCGCTGCTTCACCGCCTGCCAACGCCACAGCAGC CTCAGATACTAATGCTGGAGACCGTGGACAGACCAATAACGCCGCTTCTGCATCAGCTTCCAACTCCACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR206669 protein sequence
Red=Cloning site Green=Tags(s) MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST myc-FLAG tag |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_019827 |
| ORF Size | 1263 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NM_019827.7 |
| RefSeq Size | 8298 bp |
| RefSeq ORF | 1263 bp |
| Locus ID | 56637 |
| UniProt ID | Q9WV60 |
| MW | 46.7 kDa |
| Gene Summary | Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibit its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustain its activity. Phosphorylates ZC3HAV1 which enhances its antiviral activity. Phosphorylates SFPQ at 'Thr-679' upon T-cell activation. Phosphorylates SNAI1, leading to its BTRC-triggered ubiquitination and proteasomal degradation. Phosphorylates NR1D1 st 'Ser-55' and 'Ser-59' and stabilizes it by protecting it from proteasomal degradation. Regulates the circadian clock via phosphorylation of the major clock components including ARNTL/BMAL1, CLOCK and PER2 (PubMed:20049328, PubMed:28903391). Phosphorylates CLOCK AT 'Ser-427' and targets it for proteasomal degradation (By similarity). Phosphorylates ARNTL/BMAL1 at 'Ser-17' and 'Ser-21' and primes it for ubiquitination and proteasomal degradation (PubMed:20049328, PubMed:28903391). Phosphorylates OGT at 'Ser-3' or 'Ser-4' which positively regulates its activity. Regulates the circadian rhythmicity of hippocampal long-term potentiation and ARNTL/BMLA1 and PER2 expression (PubMed:28556462). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, leading to activate KAT5/TIP60 acetyltransferase activity and promote acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer (PubMed:22539723).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Changes in Wnt-Dependent Neuronal Morphology Underlie the Anatomical Diversification of Neocortical Homologs in Amniotes
,Nomura, T;Ohtaka-Maruyama, C;Kiyonari, H;Gotoh, H;Ono, K;,
Cell Rep
,PubMed ID 32375034
[GSK3B]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MC207532 | Gsk3b (untagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b), (10ug) |
CNY 5,488.00 |
|
| MG206669 | Gsk3b (tGFP-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b) |
CNY 7,088.00 |
|
| MR206669L1 | Lenti ORF clone of Gsk3b (Myc-DDK-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b) |
CNY 6,080.00 |
|
| MR206669L2 | Lenti ORF clone of Gsk3b (mGFP-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b) |
CNY 7,888.00 |
|
| MR206669L3 | Lenti ORF clone of Gsk3b (Myc-DDK-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b) |
CNY 6,080.00 |
|
| MR206669L4 | Lenti ORF clone of Gsk3b (mGFP-tagged) - Mouse glycogen synthase kinase 3 beta (Gsk3b) |
CNY 7,888.00 |
