Atf5 (NM_030693) Mouse Tagged ORF Clone

CAT#: MR203843

  • TrueORF®

Atf5 (Myc-DDK-tagged) - Mouse activating transcription factor 5 (Atf5), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_030693" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AFTA; Atf7; Atfx; ODA-10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203843 representing NM_030693
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACTCCTGGCGACCCTGGGACTGGAGCTGGACAGGGCCCTGCTCCCAGCTAGCGGGCTGGGCTGGC
TCGTAGACTATGGGAAACTCCCCCTGGCCCCTGCCCCCCTGGGCCCCTATGAGGTCCTTGGGGGTGCCCT
GGAGGGCGGGCTTCCAGGGGGGGGAGAGCCCCTGGCAGGTGACGGCTTCTCTGATTGGATGACTGAGCGG
GTGGACTTCACAGCTCTCCTTCCTCTGGAGGCCCCTCTGCCCCCAGGCACTCTCCCCCCACCCTCCCCGG
CCCCCCCTGACCTGGAAGCCATGGCATCCCTACTCAAGAAGGAGCTGGAACAGATGGAAGACTTCTTCCT
TGATGCCCCACTTCTCCCACCGCCCTCCCCACCACCACCTCCACCACCAGCAGCAGCACCCTCTCTGCCC
CTGCCCTTGCCCTTGCCCACCTTTGACCTCCCTCAGCCTCCTACCCTGGATACCTTGGACCTGCTGGCTG
TTTACTGCCGCAGTGAGGCCGGGCCGGGGGATTCAGGCTTGTCAACCCTGCCTGTCCCACAGCAGCCTCC
TCCTCTGGCCCCTCTGCCTTCACCCGCCCGCCCAGCCCCTTATCCTAGTCCTGCCAGCACACGAGGGGAC
CGCAAGCAAAAGAAGAGAGACCAGAATAAGTCAGCTGCTCTCAGGTACCGCCAGAGGAAGCGGGCAGAGG
GCGAGGCCCTGGAGGGCGAGTGCCAGGGGCTGGAGGCCCGGAACCGGGAGCTGAGGGAGAGGGCTGAGTC
AGTGGAGCGGGAGATCCAGTACGTGAAGGACCTGCTAATTGAGGTGTATAAGGCCCGAAGCCAGAGGACC
CGCAGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203843 representing NM_030693
Red=Cloning site Green=Tags(s)

MSLLATLGLELDRALLPASGLGWLVDYGKLPLAPAPLGPYEVLGGALEGGLPGGGEPLAGDGFSDWMTER
VDFTALLPLEAPLPPGTLPPPSPAPPDLEAMASLLKKELEQMEDFFLDAPLLPPPSPPPPPPPAAAPSLP
LPLPLPTFDLPQPPTLDTLDLLAVYCRSEAGPGDSGLSTLPVPQQPPPLAPLPSPARPAPYPSPASTRGD
RKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRT
RST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_030693
ORF Size 849 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030693.2, NP_109618.1
RefSeq Size 1753 bp
RefSeq ORF 852 bp
Locus ID 107503
UniProt ID O70191
MW 30.3 kDa
Gene Summary Transcription factor that either stimulates or represses gene transcription through binding of different DNA regulatory elements such as cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), ATF5-specific response element (ARE) (consensus: 5'-C[CT]TCT[CT]CCTT[AT]-3') but also the amino acid response element (AARE), present in many viral and cellular promoters. Critically involved, often in a cell type-dependent manner, in cell survival, proliferation, and differentiation. Its transcriptional activity is enhanced by CCND3 and slightly inhibited by CDK4 (By similarity). Important regulator of the cerebral cortex formation, functions in cerebral cortical neuroprogenitor cells to maintain proliferation and to block differentiation into neurons. Must be down-regulated in order for such cells to exit the cycle and differentiate. Participates in the pathways by which SHH promotes cerebellar granule neuron progenitor cells proliferation (PubMed:22095825). Critical for survival of mature olfactory sensory neurons (OSN), directs expression of OSN-specific genes (PubMed:23090999). May be involved in osteogenic differentiation. Promotes cell proliferation and survival by inducing the expression of EGR1 sinergistically with ELK1. Once acetylated by EP300, binds to ARE sequences on target genes promoters, such as BCL2 and EGR1 (By similarity). Plays an anti-apoptotic role through the transcriptional regulation of BCL2, this function seems to be cell type-dependent (By similarity) (PubMed:12130540). Cooperates with NR1I3/CAR in the transcriptional activation of CYP2B6 in liver. In hepatic cells, represses CRE-dependent transcription and inhibits proliferation by blocking at G2/M phase. May act as a negative regulator of IL1B transduction pathway in liver. Upon IL1B stimulus, cooperates with NLK to activate the transactivation activity of C/EBP subfamily members. Besides its function of transcription factor, acts as a cofactor of CEBPB to activate CEBPA and promote adipocyte differentiation. Regulates centrosome dynamics in a cell-cycle- and centriole-age-dependent manner. Forms 9-foci symmetrical ring scaffold around the mother centriole to control centrosome function and the interaction between centrioles and pericentriolar material (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...