Cryab (NM_009964) Mouse Tagged ORF Clone
CAT#: MR201515
- TrueORF®
Cryab (Myc-DDK-tagged) - Mouse crystallin, alpha B (Cryab)
ORF Plasmid: tGFP
"NM_009964" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Cry; Crya; Crya-2; Crya2; Hsp; HspB5; P23 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201515 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACATCGCCATCCACCACCCCTGGATCCGGCGCCCCTTCTTCCCCTTCCACTCCCCAAGCCGCCTCT TCGACCAGTTCTTCGGAGAGCACCTGTTGGAGTCTGACCTCTTCTCAACAGCCACTTCCCTGAGCCCCTT CTACCTTCGGCCACCCTCCTTCCTGCGGGCACCCAGCTGGATTGACACCGGACTCTCAGAGATGCGTTTG GAGAAGGACAGATTCTCTGTGAATCTGGACGTGAAGCACTTCTCTCCGGAGGAACTCAAAGTCAAGGTTC TGGGGGACGTGATTGAGGTCCACGGCAAGCACGAAGAACGCCAGGACGAACATGGCTTCATCTCCAGGGA GTTCCACAGGAAGTACCGGATCCCAGCCGATGTGGATCCTCTCACCATCACTTCATCCCTGTCATCTGAT GGAGTCCTCACTGTGAATGGACCAAGGAAACAGGTGTCTGGCCCTGAGCGCACCATTCCCATCACCCGTG AAGAGAAGCCTGCTGTCGCCGCAGCCCCTAAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201515 protein sequence
Red=Cloning site Green=Tags(s) MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRL EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD GVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_009964 |
ORF Size | 528 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_009964.3 |
RefSeq Size | 975 bp |
RefSeq ORF | 528 bp |
Locus ID | 12955 |
UniProt ID | P23927 |
MW | 20.1 kDa |
Gene Summary | This gene encodes a member of the small heat-shock protein (HSP20) family. The encoded protein is a molecular chaperone that protects proteins against thermal denaturation and other stresses. This protein is a component of the eye lens, regulates lens differentiation and functions as a refractive element in the lens. This protein is a negative regulator of inflammation, has anti-apoptotic properties and also plays a role in the formation of muscular tissue. Mice lacking this gene exhibit worse experimental autoimmune encephalomyelitis and inflammation of the central nervous system compared to the wild type. In mouse models, this gene has a critical role in alleviating the pathology of the neurodegenerative Alexander disease. Mutations in the human gene are associated with myofibrillar myopathy 2, fatal infantile hypertonic myofibrillar myopathy, multiple types of cataract and dilated cardiomyopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Peripherally misfolded proteins exacerbate ischemic stroke-induced neuroinflammation and brain injury
,Liu, Y;Subedi, K;Baride, A;Romanova, S;Callegari, E;Huber, CC;Wang, X;Wang, H;,
Journal of neuroinflammation
,PubMed ID 33472658
[CRYAB]
|
Peripherally expressed misfolded proteins remotely disrupt brain function and aggravate stroke-induced brain injury
,Liu, Y;Subedi, K;Baride, A;Romanova, S;Huber, CC;,
bioRxiv
[CRYAB]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC203828 | Cryab (untagged) - Mouse crystallin, alpha B (Cryab), (10ug) |
CNY 2,000.00 |
|
MG201515 | Cryab (tGFP-tagged) - Mouse crystallin, alpha B (Cryab) |
CNY 2,850.00 |
|
MR201515L1 | Lenti ORF clone of Cryab (Myc-DDK-tagged) - Mouse crystallin, alpha B (Cryab) |
CNY 4,750.00 |
|
MR201515L2 | Lenti ORF clone of Cryab (mGFP-tagged) - Mouse crystallin, alpha B (Cryab) |
CNY 4,750.00 |
|
MR201515L3 | Lenti ORF clone of Cryab (Myc-DDK-tagged) - Mouse crystallin, alpha B (Cryab) |
CNY 4,750.00 |
|
MR201515L4 | Lenti ORF clone of Cryab (mGFP-tagged) - Mouse crystallin, alpha B (Cryab) |
CNY 4,750.00 |