Fabp5 (NM_010634) Mouse Tagged ORF Clone
CAT#: MR200811
- TrueORF®
Fabp5 (Myc-DDK-tagged) - Mouse fatty acid binding protein 5, epidermal (Fabp5)
"NM_010634" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | E-FABP; Fabpe; Kl; Klbp; ma; mal1; PA-FABP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200811 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAGCCTTAAGGATCTCGAAGGGAAGTGGCGCCTGATGGAAAGCCACGGCTTTGAGGAGTACATGA AAGAGCTAGGAGTAGGACTGGCTCTTAGGAAGATGGCTGCCATGGCCAAGCCAGACTGTATCATTACGTG TGATGGCAACAACATCACGGTCAAAACCGAGAGCACAGTGAAGACGACCGTGTTCTCTTGTAACCTGGGA GAGAAGTTTGATGAAACGACAGCTGATGGCAGAAAAACTGAGACGGTCTGCACCTTCCAAGACGGTGCCC TGGTCCAGCACCAGCAATGGGACGGGAAGGAGAGCACGATAACAAGAAAACTGAAGGATGGGAAGATGAT CGTGGAGTGTGTCATGAACAATGCCACCTGCACTCGGGTCTATGAGAAGGTGCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200811 protein sequence
Red=Cloning site Green=Tags(s) MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLG EKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_010634 |
ORF Size | 408 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_010634.1, NM_010634.2, NM_010634.3, NP_034764.1 |
RefSeq Size | 969 bp |
RefSeq ORF | 408 bp |
Locus ID | 16592 |
UniProt ID | Q05816 |
MW | 15.1 kDa |
Gene Summary | The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. In humans this gene has been associated with psoriasis and type 2 diabetes. In mouse deficiency of this gene in combination with a deficiency in Fabp4 confers protection against atherosclerosis, diet-induced obesity, insulin resistance and experimental autoimmune encephalomyelitis (the mouse model for multiple sclerosis). Alternative splicing results in multiple transcript variants that encode different protein isoforms. The mouse genome contains many pseudogenes similar to this locus. [provided by RefSeq, Jan 2013] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Macrophage programming is regulated by a cooperative interaction between fatty acid binding protein 5 and peroxisome proliferator‐activated receptor γ
,null,
The FASEB Journal
,PubMed ID 35436029
[Fabp5]
|
Value of folate receptor-positive circulating tumour cells in the clinical management of indeterminate lung nodules: A non-invasive biomarker for predicting malignancy and tumour invasiveness
,Zhou, Q;Geng, Q;Wang, L;Huang, J;Liao, M;Li, Y;Ding, Z;Yang, S;Zhao, H;Shen, Q;Pan, C;Lou, J;Lu, S;Chen, C;Luo, Q;,
EBioMedicine
,PubMed ID 30872130
[FABP5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MR200811L3 | Lenti ORF clone of Fabp5 (Myc-DDK-tagged) - Mouse fatty acid binding protein 5, epidermal (Fabp5) |
CNY 3,600.00 |
|
MR200811L4 | Lenti ORF clone of Fabp5 (mGFP-tagged) - Mouse fatty acid binding protein 5, epidermal (Fabp5) |
CNY 4,750.00 |