Slpi (NM_011414) Mouse Tagged ORF Clone
CAT#: MR200750
- TrueORF®
Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi)
ORF Plasmid: tGFP
"NM_011414" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200750 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGTCCTGCGGCCTTTTACCTTTCACGGTGCTCCTTGCTCTGGGGATCCTGGCACCCTGGACTGTGG AAGGAGGCAAAAATGATGCTATCAAAATCGGAGCCTGCCCTGCTAAAAAGCCTGCCCAGTGCCTTAAGCT TGAGAAGCCACAATGCCGTACTGACTGGGAGTGCCCGGGAAAGCAGAGGTGCTGCCAAGATGCTTGCGGT TCCAAGTGCGTGAATCCTGTTCCCATTCGCAAACCAGTGTGGAGGAAGCCTGGGAGGTGCGTCAAAACTC AGGCAAGATGTATGATGCTTAACCCTCCCAATGTCTGCCAGAGGGACGGGCAGTGTGACGGCAAATACAA GTGCTGTGAGGGTATATGTGGGAAAGTCTGCCTGCCCCCGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200750 protein sequence
Red=Cloning site Green=Tags(s) MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACG SKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_011414 |
ORF Size | 396 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011414.3 |
RefSeq Size | 894 bp |
RefSeq ORF | 396 bp |
Locus ID | 20568 |
UniProt ID | P97430 |
MW | 14.3 kDa |
Gene Summary | Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:9126337). Modulates the innate immune response after bacterial infection (PubMed:12615907). Contributes to regulate the inflammatory and immune responses to the intracellular parasite L.major (PubMed:25030421). Down-regulates responses to bacterial lipopolysaccharide (LPS) (PubMed:9039268, PubMed:12615907, PubMed:25030421). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed:11017147, PubMed:12615907). Has antimicrobial activity against mycobacteria, but not against salmonella (PubMed:18322212). Contributes to normal resistance against infection by M.tuberculosis (PubMed:18322212). Required for normal resistance to L.major (PubMed:25030421). Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (PubMed:11017147, PubMed:25030421). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
The DNA methylation profile of liver tumors in C3H mice and identification of differentially methylated regions involved in the regulation of tumorigenic genes
,Matsushita, J;Okamura, K;Nakabayashi, K;Suzuki, T;Horibe, Y;Kawai, T;Sakurai, T;Yamashita, S;Higami, Y;Ichihara, G;Hata, K;Nohara, K;,
BMC Cancer
,PubMed ID 29566670
[SLPI]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC201386 | Slpi (untagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi), (10ug) |
CNY 1,200.00 |
|
MG200750 | Slpi (tGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) |
CNY 2,800.00 |
|
MR200750L3 | Lenti ORF clone of Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) |
CNY 3,600.00 |
|
MR200750L4 | Lenti ORF clone of Slpi (mGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) |
CNY 3,600.00 |