NGF (NM_002506) Human Recombinant Protein
CAT#: TP321463
Recombinant protein of human nerve growth factor (beta polypeptide) (NGF), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221463 representing NM_002506
Red=Cloning site Green=Tags(s) MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVS VWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKA LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002497 |
Locus ID | 4803 |
UniProt ID | P01138 |
Refseq Size | 1052 |
Cytogenetics | 1p13.2 |
Refseq ORF | 723 |
Synonyms | Beta-NGF; HSAN5; NGFB |
Summary | This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH321463 | NGF MS Standard C13 and N15-labeled recombinant protein (NP_002497) |
CNY 19,520.00 |
|
TP720591 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
CNY 4,550.00 |
|
TP721236 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
CNY 4,260.00 |