United States
Germany
Japan
United Kingdom
China
ZNF580 (NM_016202) Human Mass Spec Standard
CAT＃: PH314316
ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_057286)
View other "ZNF580" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_057286) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214316 |
| Predicted MW | 18.6 kDa |
| Protein Sequence |
>RC214316 representing NM_016202
Red=Cloning site Green=Tags(s) MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA THRARAGPPHTCPLCPRRFQDAAELAQHVRLH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057286 |
| RefSeq Size | 1433 |
| RefSeq ORF | 516 |
| Locus ID | 51157 |
| Cytogenetics | 19q13.42 |
| Summary | Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404118 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414134 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431774 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404118 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 2 |
CNY 3,080.00 |
|
| LY414134 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 1 |
CNY 3,080.00 |
|
| LY431774 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 3 |
CNY 3,080.00 |
|
| PH304398 | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_996998) |
CNY 19,520.00 |
|
| TP304398 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP314316 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP328746 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 3, 20 µg |
CNY 2,900.00 |
