UBE2D4 (NM_015983) Human Mass Spec Standard
CAT#: PH302473
UBE2D4 MS Standard C13 and N15-labeled recombinant protein (NP_057067)
View other "UBE2D4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | UBE2D4 MS Standard C13 and N15-labeled recombinant protein (NP_057067) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202473 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC202473 representing NM_015983
Red=Cloning site Green=Tags(s) MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057067 |
RefSeq Size | 1398 |
RefSeq ORF | 441 |
Synonyms | HBUCE1 |
Locus ID | 51619 |
Cytogenetics | 7p13 |
Summary | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414273 | UBE2D4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414273 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) |
CNY 3,080.00 |
|
TP302473 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4), 20 µg |
CNY 2,900.00 |
|
TP720161 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) |
CNY 3,710.00 |