ERG (NM_001136155) Human Tagged ORF Clone
CAT#: RG227751
- TrueORF®
ERG (tGFP-tagged) - Human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 4
ORF Plasmid: DDK
"NM_001136155" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 4,370.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | erg-3; p55 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG227751 representing NM_001136155
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAGCACTATTAAGGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACG GAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGAT GAGCCC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG227751 representing NM_001136155
Red=Cloning site Green=Tags(s) MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMS TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001136155 |
ORF Size | 1161 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001136155.1, NP_001129627.1 |
RefSeq Size | 4727 bp |
RefSeq ORF | 1164 bp |
Locus ID | 2078 |
UniProt ID | P11308 |
Protein Families | Druggable Genome, Transcription Factors |
Gene Summary | This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC227751 | ERG (Myc-DDK-tagged)-Human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 4 |
CNY 3,990.00 |
|
RC227751L3 | Lenti-ORF clone of ERG (Myc-DDK-tagged)-Human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 4 |
CNY 5,890.00 |
|
RC227751L4 | Lenti-ORF clone of ERG (mGFP-tagged)-Human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 4 |
CNY 5,890.00 |
|
SC325032 | ERG (untagged)-Human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 4 |
CNY 7,220.00 |