LMO2 (NM_005574) Human Tagged ORF Clone
CAT#: RC229124
- TrueORF®
LMO2 (Myc-DDK-tagged)-Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1
ORF Plasmid: tGFP
"NM_005574" in other vectors (11)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 4,180.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | LMO-2; RBTN2; RBTNL1; RHOM2; TTG2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC229124 representing NM_005574
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAAGGGAGCGCGGTGACTGTCCTTGAGCGCGGAGGGGCGAGCTCGCCGGCGGAGCGCCGGAGCAAGC GGAGGCGCAGGAGCGGCGGCGACGGCGGCGGCGGCGGCGGCGCCCGAGCACCCGAGGGGGTCCGAGCCCC GGCAGCCGGCCAGCCCCGCGCCACAAAGGGAGCGCCCCCGCCGCCCGGCACCCCGCCTCCCTCCCCAATG TCCTCGGCCATCGAAAGGAAGAGCCTGGACCCTTCAGAGGAACCAGTGGATGAGGTGCTGCAGATCCCCC CATCCCTGCTGACATGCGGCGGCTGCCAGCAGAACATTGGGGACCGCTACTTCCTGAAGGCCATCGACCA GTACTGGCACGAGGACTGCCTGAGCTGCGACCTCTGTGGCTGCCGGCTGGGTGAGGTGGGGCGGCGCCTC TACTACAAACTGGGCCGGAAGCTCTGCCGGAGAGACTATCTCAGGCTTTTTGGGCAAGACGGTCTCTGCG CATCCTGTGACAAGCGGATTCGTGCCTATGAGATGACAATGCGGGTGAAAGACAAAGTGTATCACCTGGA ATGTTTCAAATGCGCCGCCTGTCAGAAGCATTTCTGTGTAGGTGACAGATACCTCCTCATCAACTCTGAC ATAGTGTGCGAACAGGACATCTACGAGTGGACTAAGATCAATGGGATGATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229124 representing NM_005574
Red=Cloning site Green=Tags(s) MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPM SSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRL YYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSD IVCEQDIYEWTKINGMI myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005574 |
ORF Size | 681 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005574.4 |
RefSeq ORF | 684 bp |
Locus ID | 4005 |
UniProt ID | P25791 |
Domains | LIM |
Protein Families | Druggable Genome |
MW | 24.9 kDa |
Gene Summary | LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205376 | LMO2 (Myc-DDK-tagged)-Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 1,200.00 |
|
RC205376L1 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205376L2 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC205376L3 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205376L4 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RC229124L1 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC229124L3 | Lenti ORF clone of Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RG205376 | LMO2 (tGFP-tagged) - Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 2,800.00 |
|
RG229124 | LMO2 (tGFP-tagged) - Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 5,200.00 |
|
SC116662 | LMO2 (untagged)-Human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 1,800.00 |
|
SC327759 | LMO2 (untagged)-Human LIM domain only 2 (rhombotin-like 1) (LMO2) transcript variant 1 |
CNY 3,990.00 |