IL22 (NM_020525) Human Tagged ORF Clone
CAT#: RC209995
IL22 (Myc-DDK-tagged)-Human interleukin 22 (IL22)
ORF Plasmid: tGFP
"NM_020525" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209995 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGCCCTGCAGAAATCTGTGAGCTCTTTCCTTATGGGGACCCTGGCCACCAGCTGCCTCCTTCTCT TGGCCCTCTTGGTACAGGGAGGAGCAGCTGCGCCCATCAGCTCCCACTGCAGGCTTGACAAGTCCAACTT CCAGCAGCCCTATATCACCAACCGCACCTTCATGCTGGCTAAGGAGGCTAGCTTGGCTGATAACAACACA GACGTTCGTCTCATTGGGGAGAAACTGTTCCACGGAGTCAGTATGAGTGAGCGCTGCTATCTGATGAAGC AGGTGCTGAACTTCACCCTTGAAGAAGTGCTGTTCCCTCAATCTGATAGGTTCCAGCCTTATATGCAGGA GGTGGTGCCCTTCCTGGCCAGGCTCAGCAACAGGCTAAGCACATGTCATATTGAAGGTGATGACCTGCAT ATCCAGAGGAATGTGCAAAAGCTGAAGGACACAGTGAAAAAGCTTGGAGAGAGTGGAGAGATCAAAGCAA TTGGAGAACTGGATTTGCTGTTTATGTCTCTGAGAAATGCCTGCATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209995 protein sequence
Red=Cloning site Green=Tags(s) MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_020525 |
ORF Size | 537 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_020525.5 |
RefSeq Size | 1147 bp |
RefSeq ORF | 540 bp |
Locus ID | 50616 |
UniProt ID | Q9GZX6 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
MW | 20 kDa |
Gene Summary | This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Patients with autoimmune polyendocrine syndrome type 1 have an increased susceptibility to severe herpesvirus infections
,null,
Clinical Immunology (Orlando, Fla.)
,PubMed ID 34508889
[IL22]
|
Long Interleukin-22 Binding Protein Isoform-1 Is an Intracellular Activator of the Unfolded Protein Response
,Gómez-Fernández, P;Urtasun, A;Paton, AW;Paton, JC;Borrego, F;Dersh, D;Argon, Y;Alloza, I;Vandenbroeck, K;,
Front Immunol
,PubMed ID 30619294
[IL22]
|
Clinical and immunological characteristics of Autoimmune Addison's disease: a nationwide Swedish multicenter study
,Dalin, F;Nordling Eriksson, G;Dahlqvist, P;Hallgren, Å;Wahlberg, J;Ekwall, O;Söderberg, S;Rönnelid, J;Olcén, P;Winqvist, O;Catrina, SB;Kriström, B;Laudius, M;Isaksson, M;Halldin Stenlid, M;Gustafsson, J;Gebre-Medhin, G;Björnsdottir, S;Janson, A;Åkerman, AK;Åman, J;Duchen, K;Bergthorsdottir, R;Johannsson, G;Lindskog, E;Landin-Olsson, M;Elfving, M;Waldenström, E;Hulting, AL;Kämpe, O;Bensing, S;,
J. Clin. Endocrinol. Metab.
,PubMed ID 27870550
[IL22]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209995L1 | Lenti ORF clone of Human interleukin 22 (IL22), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC209995L2 | Lenti ORF clone of Human interleukin 22 (IL22), mGFP tagged |
CNY 6,000.00 |
|
RC209995L3 | Lenti ORF clone of Human interleukin 22 (IL22), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC209995L4 | Lenti ORF clone of Human interleukin 22 (IL22), mGFP tagged |
CNY 6,000.00 |
|
RG209995 | IL22 (tGFP-tagged) - Human interleukin 22 (IL22) |
CNY 5,200.00 |
|
SC304781 | IL22 (untagged)-Human interleukin 22 (IL22) |
CNY 3,600.00 |
|
SC321140 | IL22 (untagged)-Human interleukin 22 (IL22) |
CNY 3,600.00 |