SC35 (SRSF2) (NM_003016) Human Tagged ORF Clone
CAT#: RC209842
- TrueORF®
SRSF2 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1
ORF Plasmid: tGFP
"NM_003016" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | PR264; SC-35; SC35; SFRS2; SFRS2A; SRp30b |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209842 representing NM_003016
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCTACGGCCGCCCCCCTCCCGATGTGGAGGGTATGACCTCCCTCAAGGTGGACAACCTGACCTACC GCACCTCGCCCGACACGCTGAGGCGCGTCTTCGAGAAGTACGGGCGCGTCGGCGACGTGTACATCCCGCG GGATCGCTACACCAAGGAGTCCCGCGGCTTCGCCTTCGTTCGCTTTCACGACAAGCGCGACGCTGAGGAC GCTATGGATGCCATGGACGGGGCCGTGCTGGACGGCCGCGAGCTGCGGGTGCAAATGGCGCGCTACGGCC GCCCCCCGGACTCACACCACAGCCGCCGGGGACCGCCACCCCGCAGGTACGGGGGCGGTGGCTACGGACG CCGGAGCCGCAGCCCTAGGCGGCGTCGCCGCAGCCGATCCCGGAGTCGGAGCCGTTCCAGGTCTCGCAGC CGATCTCGCTACAGCCGCTCGAAGTCTCGGTCCCGCACTCGTTCTCGATCTCGGTCGACCTCCAAGTCCA GATCCGCACGAAGGTCCAAGTCCAAGTCCTCGTCGGTCTCCAGATCTCGTTCGCGGTCCAGGTCCCGGTC TCGGTCCAGGAGTCCTCCCCCAGTGTCCAAGAGGGAATCCAAATCCAGGTCGCGATCGAAGAGTCCCCCC AAGTCTCCTGAAGAGGAAGGAGCGGTGTCCTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209842 representing NM_003016
Red=Cloning site Green=Tags(s) MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED AMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRS RSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPP KSPEEEGAVSS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003016 |
ORF Size | 663 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003016.3 |
RefSeq Size | 2923 bp |
RefSeq ORF | 666 bp |
Locus ID | 6427 |
UniProt ID | Q01130 |
Domains | RRM |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Spliceosome |
MW | 25.3 kDa |
Gene Summary | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding the same protein and one non-coding transcript variant have been found for this gene. In addition, a pseudogene of this gene has been found on chromosome 11. [provided by RefSeq, Sep 2010] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
SRSF1 and PTBP1 are trans-acting factors that suppress the formation of a CD33 splicing isoform linked to Alzheimer's disease risk
,van Bergeijk, P;Seneviratne, U;Aparicio-Prat, E;Stanton, R;Hasson, SA;,
Mol. Cell. Biol.
,PubMed ID 31208978
[SC35]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209842L1 | Lenti ORF clone of Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC209842L2 | Lenti ORF clone of Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC209842L3 | Lenti ORF clone of Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC209842L4 | Lenti ORF clone of Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RG209842 | SRSF2 (tGFP-tagged) - Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1 |
CNY 5,200.00 |
|
SC118248 | SRSF2 (untagged)-Human serine/arginine-rich splicing factor 2 (SRSF2), transcript variant 1 |
CNY 3,600.00 |