RNF4 (NM_002938) Human Tagged ORF Clone
CAT#: RC207273
RNF4 (Myc-DDK-tagged)-Human ring finger protein 4 (RNF4), transcript variant 2
ORF Plasmid: tGFP
"NM_002938" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 7 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | RES4-26; SLX5; SNURF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207273 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTACAAGAAAGCGTCGTGGTGGAGCAATAAATTCTAGACAAGCTCAGAAGCGAACTCGGGAAGCGA CCTCCACCCCCGAGATCTCCTTGGAAGCAGAACCCATAGAACTCGTGGAAACTGCTGGAGATGAAATTGT GGACCTCACTTGTGAATCTTTAGAGCCTGTGGTGGTTGATCTGACTCACAATGACTCTGTTGTGATTGTT GACGAAAGAAGAAGACCAAGGAGGAATGCTAGGAGGCTGCCCCAGGACCATGCTGACAGCTGTGTGGTGA GCAGTGACGATGAGGAGTTGTCCAGGGACAGGGACGTATATGTGACTACCCATACTCCCAGAAACGCCAG GGATGAGGGCGCTACAGGCCTCAGGCCCTCAGGTACTGTCAGTTGTCCCATCTGCATGGACGGATACTCA GAGATCGTGCAGAATGGACGTCTCATCGTTTCCACAGAATGCGGCCATGTCTTCTGTAGCCAGTGCCTCC GTGATTCCCTGAAGAATGCTAATACTTGCCCAACTTGTAGGAAAAAGATCAACCACAAACGGTACCACCC CATTTATATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207273 protein sequence
Red=Cloning site Green=Tags(s) MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002938 |
ORF Size | 570 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002938.5 |
RefSeq Size | 2971 bp |
RefSeq ORF | 573 bp |
Locus ID | 6047 |
UniProt ID | P78317 |
Domains | RING |
Protein Families | Transcription Factors |
MW | 21.3 kDa |
Gene Summary | The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. A pseudogene of this gene is found on chromosome 1.[provided by RefSeq, Jul 2010] |
Citations (7)
The use of this cDNA Clones has been cited in the following citations: |
---|
SPRTN patient variants cause global-genome DNA-protein crosslink repair defects
,null,
Nature Communications
,PubMed ID 36681662
[RNF4]
|
The ubiquitin-dependent ATPase p97 removes cytotoxic trapped PARP1 from chromatin
,null,
Nature Cell Biology
,PubMed ID 35013556
[RNF4]
|
A conserved SUMO-Ubiquitin pathway directed by RNF4/SLX5-SLX8 and PIAS4/SIZ1 drives proteasomal degradation of topoisomerase DNA-protein crosslinks
,Sun, Y;Jenkins, LMM;Su, YP;Nitiss, KC;Nitiss, JL;,
bioRxiv
[RNF4]
|
Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications
,null,
ACS chemical biology
,PubMed ID 31059647
[RNF4]
|
Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications
,Ward, C;Kleinman, J;Brittain, S;Lee, P;Chung, C;Kim, K;Petri, Y;Thomas, J;Tallarico, J;McKenna, J;Schirle, M;Nomura, D;,
bioRxiv
[RNF4]
|
Trafficking of the Transcription Factor Nrf2 to Promyelocytic Leukemia-Nuclear Bodies: IMPLICATIONS FOR DEGRADATION OF NRF2 IN THE NUCLEUS
,Melanie Theodore Malloy, Deneshia J. McIntosh, Treniqka S. Walters, Andrea Flores, J. Shawn Goodwin, and Ifeanyi J. Arinze,
J. Biol. Chem., May 2013; 288: 14569 - 14583.
,PubMed ID 23543742
[RNF4]
|
Trafficking of the Transcription Factor Nrf2 to Promyelocytic Leukemia-Nuclear Bodies: IMPLICATIONS FOR DEGRADATION OF NRF2 IN THE NUCLEUS*
,Flores, J;Ifeanyi, J;McIntosh, TSW;Malloy, AMT;,
The American Society for Biochemistry and Molecular Biology
[RNF4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207273L1 | Lenti ORF clone of Human ring finger protein 4 (RNF4), transcript variant 2, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC207273L2 | Lenti ORF clone of Human ring finger protein 4 (RNF4), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC207273L3 | Lenti ORF clone of Human ring finger protein 4 (RNF4), transcript variant 2, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC207273L4 | Lenti ORF clone of Human ring finger protein 4 (RNF4), transcript variant 2, mGFP tagged |
CNY 4,800.00 |
|
RG207273 | RNF4 (tGFP-tagged) - Human ring finger protein 4 (RNF4), transcript variant 2 |
CNY 4,000.00 |
|
SC110999 | RNF4 (untagged)-Human ring finger protein 4 (RNF4), transcript variant 2 |
CNY 2,400.00 |