Corticotropin Releasing Factor (CRH) (NM_000756) Human Tagged ORF Clone
CAT#: RC203144
CRH (Myc-DDK-tagged)-Human corticotropin releasing hormone (CRH)
ORF Plasmid: tGFP
"NM_000756" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CRF; CRH1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203144 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGGCTGCCGCTGCTTGTGTCCGCGGGAGTCCTGCTGGTGGCTCTCCTGCCCTGCCCGCCATGCAGGG CGCTCCTGAGCCGCGGGCCGGTCCCGGGAGCTCGGCAGGCGCCGCAGCACCCTCAGCCCTTGGATTTCTT CCAGCCGCCGCCGCAGTCCGAGCAGCCCCAGCAGCCGCAGGCTCGGCCGGTCCTGCTCCGCATGGGAGAG GAGTACTTCCTCCGCCTGGGGAACCTCAACAAGAGCCCGGCCGCTCCCCTTTCGCCCGCCTCCTCGCTCC TCGCCGGCGGCAGCGGCAGCCGCCCTTCGCCGGAACAGGCGACCGCCAACTTTTTCCGCGTGTTGCTGCA GCAGCTGCTGCTGCCTCGGCGCTCGCTCGACAGCCCCGCGGCTCTCGCGGAGCGCGGCGCTAGGAATGCC CTCGGCGGCCACCAGGAGGCACCGGAGAGAGAAAGGCGGTCCGAGGAGCCTCCCATCTCCCTGGATCTCA CCTTCCACCTCCTCCGGGAAGTCTTGGAAATGGCCAGGGCCGAGCAGTTAGCACAGCAAGCTCACAGCAA CAGGAAACTCATGGAGATTATTGGGAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203144 protein sequence
Red=Cloning site Green=Tags(s) MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE EYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNA LGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000756 |
ORF Size | 588 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000756.4 |
RefSeq Size | 1434 bp |
RefSeq ORF | 591 bp |
Locus ID | 1392 |
UniProt ID | P06850 |
Domains | CRF |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Long-term depression |
MW | 21.4 kDa |
Gene Summary | This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Nov 2015] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
The nutrient and energy sensor Sirt1 regulates the hypothalamic-pituitary-adrenal (HPA) axis by altering the production of the prohormone convertase 2 (PC2) essential in the maturation of corticotropin releasing hormone (CRH) from its prohormone in male r
,Toorie, AM;Cyr, NE;Steger, JS;Beckman, R;Farah, G;Nillni, EA;,
J. Biol. Chem.
,PubMed ID 26755731
[Corticotropin Releasing Factor]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203144L1 | Lenti ORF clone of Human corticotropin releasing hormone (CRH), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC203144L2 | Lenti ORF clone of Human corticotropin releasing hormone (CRH), mGFP tagged |
CNY 5,890.00 |
|
RC203144L3 | Lenti ORF clone of Human corticotropin releasing hormone (CRH), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203144L4 | Lenti ORF clone of Human corticotropin releasing hormone (CRH), mGFP tagged |
CNY 5,890.00 |
|
RG203144 | CRH (tGFP-tagged) - Human corticotropin releasing hormone (CRH) |
CNY 4,000.00 |
|
SC119702 | CRH (untagged)-Human corticotropin releasing hormone (CRH) |
CNY 2,400.00 |
|
SC320891 | CRH (untagged)-Human corticotropin releasing hormone (CRH) |
CNY 2,400.00 |
其它Corticotropin Releasing Factor产品