ID1 (NM_002165) Human Tagged ORF Clone
CAT#: RC202061
ID1 (Myc-DDK-tagged)-Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1
ORF Plasmid: tGFP
"NM_002165" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | bHLHb24; ID |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202061 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAGTCGCCAGTGGCAGCACCGCCACCGCCGCCGCGGGCCCCAGCTGCGCGCTGAAGGCCGGCAAGA CAGCGAGCGGTGCGGGCGAGGTGGTGCGCTGTCTGTCTGAGCAGAGCGTGGCCATCTCGCGCTGCGCCGG GGGCGCCGGGGCGCGCCTGCCTGCCCTGCTGGACGAGCAGCAGGTAAACGTGCTGCTCTACGACATGAAC GGCTGTTACTCACGCCTCAAGGAGCTGGTGCCCACCCTGCCCCAGAACCGCAAGGTGAGCAAGGTGGAGA TTCTCCAGCACGTCATCGACTACATCAGGGACCTTCAGTTGGAGCTGAACTCGGAATCCGAAGTTGGAAC CCCCGGGGGCCGAGGGCTGCCGGTCCGGGCTCCGCTCAGCACCCTCAACGGCGAGATCAGCGCCCTGACG GCCGAGGCGGCATGCGTTCCTGCGGACGATCGCATCTTGTGTCGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202061 protein sequence
Red=Cloning site Green=Tags(s) MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT AEAACVPADDRILCR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002165 |
ORF Size | 465 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002165.4 |
RefSeq Size | 1000 bp |
RefSeq ORF | 468 bp |
Locus ID | 3397 |
UniProt ID | P41134 |
Domains | HLH |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
MW | 16.1 kDa |
Gene Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Crosstalk between the RNA Methylation and Histone-Binding Activities of MePCE Regulates P-TEFb Activation on Chromatin
,Shelton, SB;Shah, NM;Abell, NS;Devanathan, SK;Mercado, M;Xhemalçe, B;,
Cell Rep
,PubMed ID 29425494
[ID1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202061L1 | Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC202061L2 | Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, mGFP tagged |
CNY 4,200.00 |
|
RC202061L3 | Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC202061L4 | Lenti ORF clone of Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, mGFP tagged |
CNY 4,200.00 |
|
RG202061 | ID1 (tGFP-tagged) - Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 |
CNY 3,400.00 |
|
SC125462 | ID1 (untagged)-Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 |
CNY 1,800.00 |