Uridine Phosphorylase 1 (UPP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UPP1 antibody: synthetic peptide directed towards the N terminal of human UPP1. Synthetic peptide located within the following region: AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	uridine phosphorylase 1
Database Link	NP_003355 Entrez Gene 7378 Human UniProt ID Q16831
Background	UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Synonyms	UDRPASE; UP; UPASE; UPP
Note	Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 85%; Bovine: 85%; Horse: 83%; Zebrafish: 83%; Pig: 75%; Guinea pig: 75%
Reference Data
Protein Pathways	Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.