GABRE Rabbit Polyclonal Antibody
CAT#: TA338544
Rabbit Polyclonal Anti-GABRE Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GABRE antibody: synthetic peptide directed towards the N terminal of human GABRE. Synthetic peptide located within the following region: DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | gamma-aminobutyric acid type A receptor epsilon subunit |
Database Link | |
Background | The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein. [provided by RefSeq, Oct 2008] |
Synonyms | epsilon; GABA(A) receptor; gamma-aminobutyric acid (GABA) A receptor; OTTHUMP00000025892 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 86%; Pig: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |