MYLC2PL (MYL10) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MYL10 antibody is: synthetic peptide directed towards the N-terminal region of Human MYL10. Synthetic peptide located within the following region: ARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	myosin light chain 10
Database Link	NP_612412 Entrez Gene 93408 Human UniProt ID Q9BUA6
Background	The function of this protein remains unknown.
Synonyms	MYLC2PL; PLRLC
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Pathways	Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.