GCNT3 Rabbit Polyclonal Antibody
CAT#: TA332087
Rabbit Polyclonal Anti-GCNT3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,381.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | glucosaminyl (N-acetyl) transferase 3, mucin type |
Database Link | |
Background | This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface. |
Synonyms | 4GnT; C2; C2GNT2; C2GNTM; C24GNT; GNTM |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 91%; Yeast: 89% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, O-Glycan biosynthesis |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Downregulation of N-Acetylglucosaminyltransferase GCNT3 by miR-302b-3p Decreases Non-Small Cell Lung Cancer (NSCLC) Cell Proliferation, Migration and Invasion
,Li, Q;Ran, P;Zhang, X;Guo, X;Yuan, Y;Dong, T;Zhu, B;Zheng, S;Xiao, C;,
Cell. Physiol. Biochem.
,PubMed ID 30355927
[GCNT3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |