ELOB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	transcription elongation factor B subunit 2
Database Link	NP_009039 Entrez Gene 6923 Human UniProt ID Q15370
Background	TCEB2 is the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Synonyms	ELOB; SIII
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.