Efna4 (NM_007910) Mouse Recombinant Protein
CAT#: TP526276
Purified recombinant protein of Mouse ephrin A4 (Efna4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Efna4" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226276 representing NM_007910
Red=Cloning site Green=Tags(s) MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGP ETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPT PESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGWRGGHAPSPLCLLLLLLLPILRLLRVL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031936 |
Locus ID | 13639 |
UniProt ID | O08542, Q3UQB5, Q9CZS8 |
Refseq Size | 1596 |
Cytogenetics | 3 39.07 cM |
Refseq ORF | 618 |
Synonyms | EFL-4; Epl4; LERK-4 |
Summary | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP721087 | Purified recombinant protein of Mouse ephrin A4 (Efna4) |
CNY 4,260.00 |