ENAH (NM_018212) Human Recombinant Protein
CAT#: TP315455
Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 2, 20 µg
View other "ENAH" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215455 representing NM_018212
Red=Cloning site Green=Tags(s) MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP EPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAI RQELSKSNTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060682 |
Locus ID | 55740 |
UniProt ID | Q8N8S7, A0A4D6J698 |
Refseq Size | 13109 |
Cytogenetics | 1q42.12 |
Refseq ORF | 1710 |
Synonyms | ENA; MENA; NDPP1 |
Summary | This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016] |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423439 | ENAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423439 | Transient overexpression lysate of enabled homolog (Drosophila) (ENAH), transcript variant 1 |
CNY 3,080.00 |
|
PH310677 | ENAH MS Standard C13 and N15-labeled recombinant protein (NP_001008493) |
CNY 19,520.00 |
|
PH315455 | ENAH MS Standard C13 and N15-labeled recombinant protein (NP_060682) |
CNY 14,250.00 |
|
TP310677 | Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 1, 20 µg |
CNY 2,900.00 |