MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

CAT#: TP307294

Recombinant protein of human myosin, light chain 12A, regulatory, non-sarcomeric (MYL12A), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "MRCL3" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Rabbit polyclonal Myosin phospho S19/phospho S20 antibody
    • 100 ug

CNY 8,027.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC207294 protein sequence
Red=Cloning site Green=Tags(s)

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_006462
Locus ID 10627
UniProt ID P19105
Refseq Size 1243
Cytogenetics 18p11.31
Refseq ORF 513
Synonyms HEL-S-24; MLC-2B; MLCB; MRCL3; MRLC3; MYL2B
Summary This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]
Protein Pathways Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...