United States
Germany
Japan
United Kingdom
China
PDE9A (NM_001001568) Human Mass Spec Standard
CAT＃: PH324133
PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568)
View other "PDE9A" proteins (27)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224133 |
| Predicted MW | 54.3 kDa |
| Protein Sequence |
>RC224133 representing NM_001001568
Red=Cloning site Green=Tags(s) MDAFRSTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVE IEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWE PNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKF SQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPD GFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESR DRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA TRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001001568 |
| RefSeq Size | 1774 |
| RefSeq ORF | 1398 |
| Synonyms | HSPDE9A2 |
| Locus ID | 5152 |
| Cytogenetics | 21q22.3 |
| Summary | The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419224 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424385 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424386 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424388 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424391 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424392 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424393 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424394 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424395 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424399 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424400 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY419224 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 1 |
CNY 4,840.00 |
|
| LY424385 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 3 |
CNY 4,840.00 |
|
| LY424386 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 4 |
CNY 4,840.00 |
|
| LY424388 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 6 |
CNY 4,840.00 |
|
| LY424391 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 9 |
CNY 4,840.00 |
|
| LY424392 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 10 |
CNY 4,840.00 |
|
| LY424393 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 11 |
CNY 3,080.00 |
|
| LY424394 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 12 |
CNY 4,840.00 |
|
| LY424395 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 13 |
CNY 4,840.00 |
|
| LY424399 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 17 |
CNY 4,840.00 |
|
| LY424400 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 18 |
CNY 4,840.00 |
|
| PH317127 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001578) |
CNY 14,250.00 |
|
| PH324417 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001574) |
CNY 14,250.00 |
|
| TP317127 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 13, 20 µg |
CNY 2,900.00 |
|
| TP324133 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP324417 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 9, 20 µg |
CNY 2,900.00 |
