Tryptophanyl tRNA synthetase (WARS) (NM_173701) Human Mass Spec Standard
CAT#: PH313605
WARS MS Standard C13 and N15-labeled recombinant protein (NP_776049)
View other "Tryptophanyl tRNA synthetase" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | WARS MS Standard C13 and N15-labeled recombinant protein (NP_776049) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213605 |
Predicted MW | 53.2 kDa |
Protein Sequence |
>RC213605 protein sequence
Red=Cloning site Green=Tags(s) MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_776049 |
RefSeq Size | 2660 |
RefSeq ORF | 1413 |
Synonyms | GAMMA-2; HMN9; IFI53; IFP53; WARS |
Locus ID | 7453 |
Cytogenetics | 14q32.2 |
Summary | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401346 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406568 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401346 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 1 |
CNY 3,080.00 |
|
LY406568 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 2 |
CNY 4,840.00 |
|
TP313605 | Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720622 | Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1 |
CNY 4,360.00 |
|
TP760112 | Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Tryptophanyl tRNA synthetase产品