Apolipoprotein CII (APOC2) (NM_000483) Human Mass Spec Standard
CAT#: PH302771
APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474)
View other "Apolipoprotein CII" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202771 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC202771 protein sequence
Red=Cloning site Green=Tags(s) MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000474 |
RefSeq Size | 738 |
RefSeq ORF | 303 |
Synonyms | APO-CII; APOC-II |
Locus ID | 344 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424693 | APOC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424693 | Transient overexpression lysate of apolipoprotein C-II (APOC2) |
CNY 3,080.00 |
|
TP302771 | Recombinant protein of human apolipoprotein C-II (APOC2), 20 µg |
CNY 2,900.00 |
|
TP721060 | Purified recombinant protein of Human apolipoprotein C-II (APOC2) |
CNY 5,460.00 |
其它Apolipoprotein CII产品