RAD54B (NM_001205262) Human Tagged ORF Clone

CAT#: RG231696

  • TrueORF®

RAD54B (tGFP-tagged) - Homo sapiens RAD54 homolog B (S. cerevisiae) (RAD54B), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001205262" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


RAD54B rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms RDH54
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG231696 representing NM_001205262
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACGATCTGCAGCACCAAGTCAGTTGCAGGGGAATTCCTTCAAAAAACCAAAATTTATACCTCCAG
GAAGAAGTAATCCAGGTCTGAATGAAGAGATTACAAAACTGAATCCAGATATAAAATTATTTGAGGGTGT
TGCAATTAATAACACCTTTCTCCCGTCACAAAATGATCTTAGAATATGCAGTTTAAATCTGCCTAGTGAA
GAAAGTACTAGAGAAATCAATAACAGAGATAATTGCAGTGGAAAATATTGTTTTGAAGCACCTACACTGG
CAACATTAGATCCACCTCATACAGTGCAAACTTGGATGAGGAGGCACAGGCTGGTACCAGTTCACTACAG
G


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG231696 representing NM_001205262
Red=Cloning site Green=Tags(s)

MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDLRICSLNLPSE
ESTREINNRDNCSGKYCFEAPTLATLDPPHTVQTWMRRHRLVPVHYR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001205262
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001205262.3
RefSeq Size 5380 bp
RefSeq ORF 354 bp
Locus ID 25788
UniProt ID O95073
Protein Families Druggable Genome
Protein Pathways Homologous recombination
Gene Summary The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...