VAMP4 (NM_001185127) Human Tagged ORF Clone

CAT#: RG230977

  • TrueORF®

VAMP4 (tGFP-tagged) - Human vesicle-associated membrane protein 4 (VAMP4), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001185127" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-VAMP4 Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms VAMP-4; VAMP24
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG230977 representing NM_001185127
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCCCAAGTTTAAGCGCCACCTCAATGATGATGATGTCACAGGTTCTGTGAAAAGTGAAAGGAGAA
ATCTTTTGGAAGATGATTCAGATGAAGAAGAGGACTTTTTTCTGGGACCATCTGGACCAAGATTTGGACC
TAGAAATGATAAAATTAAGCATGTTCAGAATCAAGTGGATGAAGTTATTGATGTCATGCAAGAAAATATT
ACAAAGGTAATTGAGAGAGGGGAGAGACTAGATGAACTACAGGACAAATCAGAAAGCTTATCGGATAATG
CAACAGCTTTTAGCAACAGATCCAAACAACTTCGAAGGCAAATGTGGTGGCGTGGATGCAAAATAAAAGC
CATCATGGCTTTGGTTGCTGCTATCCTTTTGCTAGTGATTATCATTCTTATAGTCATGAAATACCGTACT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG230977 representing NM_001185127
Red=Cloning site Green=Tags(s)

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI
TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001185127
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001185127.2
RefSeq Size 5152 bp
RefSeq ORF 423 bp
Locus ID 8674
UniProt ID O75379
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Gene Summary Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...